제품 > 항체 > 다중클론항체(pAb)

USP47 Rabbit pAb (A15461)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using USP47 Rabbit pAb (A15461) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - USP47 Rabbit pAb (A15461)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using USP47 Rabbit pAb (A15461) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	USP47 Rabbit pAb
Catalog No.	A15461
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables WD40-repeat domain binding activity and thiol-dependent deubiquitinase. Involved in several processes, including monoubiquitinated protein deubiquitination; negative regulation of G2/M transition of mitotic cell cycle; and negative regulation of nitrogen compound metabolic process. Located in cytoplasm. Part of SCF ubiquitin ligase complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1128-1287 of human USP47 (NP_060414.3).
Sequence	VEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
Gene ID
Swiss Prot
Synonyms	TRFP; USP47
Calculated MW	157kDa
Observed MW	180kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, HeLa, SGC-7901, Mouse brain
Cellular location	Cytoplasm
Customer validation	WB(Homo sapiens)