Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | VPS11 Rabbit mAb |
---|---|
Catalog No. | A19798 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2325 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS11 (Q9H270). |
---|---|
Sequence | MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILA |
Gene ID | |
Swiss Prot | |
Synonyms | END1; PEP5; HLD12; RNF108; hVPS11; DYT32; VPS11 |
Calculated MW | 108kDa |
Observed MW | 108kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, A-431, Raji, Mouse testis, Mouse brain |
Cellular location | autophagosome, clathrin-coated vesicle, CORVET complex, early endosome, endosome, late endosome, lysosome |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.