제품 > 항체 > 다중클론항체(pAb)

VWC2L Rabbit pAb (A17853)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using VWC2L Rabbit pAb (A17853) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Overview

Product name	VWC2L Rabbit pAb
Catalog No.	A17853
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Acts upstream of or within negative regulation of BMP signaling pathway and positive regulation of neuron differentiation. Located in extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; central nervous system; hippocampus; hypothalamus; and thalamus. Orthologous to human VWC2L (von Willebrand factor C domain containing 2 like).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-50 of mouse VWC2L (NP_796138.2).
Sequence	MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQASSNDNLIFDDYRG
Gene ID
Swiss Prot
Synonyms	Brl; A830006F12Rik; VWC2L
Calculated MW
Observed MW	23kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-251MG, SH-SY5Y, Mouse heart
Cellular location