Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Versican Rabbit mAb |
---|---|
Catalog No. | A19655 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2216 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 3200-3396 of human Versican (P13611). |
---|---|
Sequence | QGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR |
Gene ID | |
Swiss Prot | |
Synonyms | WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; Versican |
Calculated MW | 373kDa |
Observed MW | 265kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | SH-SY5Y, Mouse brain |
Cellular location | endoplasmic reticulum lumen, extracellular region, extracellular space, Golgi lumen, interphotoreceptor matrix, lysosomal lumen, photoreceptor outer segment. |
Customer validation | WB(Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19655? Please let us know so that we can cite the reference in this datasheet.