제품 > 항체 > 단일클론항체(mAb)

WAVE2/WASF2 Rabbit mAb (A19601)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using WAVE2/WAVE2/WASF2 Rabbit mAb (A19601) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - WAVE2/WASF2 Rabbit mAb (A19601)

Immunohistochemistry analysis of paraffin-embedded mouse testis using WAVE2/WAVE2/WASF2 Rabbit mAb (A19601) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat kidney using WAVE2/WAVE2/WASF2 Rabbit mAb (A19601) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	WAVE2/WASF2 Rabbit mAb
Catalog No.	A19601
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2191

Background

This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 399-498 of human WAVE2/WASF2 (Q9Y6W5).
Sequence	PPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD
Gene ID
Swiss Prot
Synonyms	IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; WAVE2/WASF2
Calculated MW	54kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, K-562, Mouse testis, Mouse thymus
Cellular location	Actin cytoskeleton, Basolateral plasma membrane, Cell-cell junction, Cytosol, early endosome, Extracellular exosome, SCAR complex
Customer validation	WB(Homo sapiens)