제품 > 항체 > 단일클론항체(mAb)

WEE1 Rabbit mAb (A22275)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Immunohistochemistry analysis of paraffin-embedded Mouse lung using WEE1 Rabbit mAb (A22275) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	WEE1 Rabbit mAb
Catalog No.	A22275
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57004

Background

This gene encodes a nuclear protein, which is a tyrosine kinase belonging to the Ser/Thr family of protein kinases. This protein catalyzes the inhibitory tyrosine phosphorylation of CDC2/cyclin B kinase, and appears to coordinate the transition between DNA replication and mitosis by protecting the nucleus from cytoplasmically activated CDC2 kinase.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WEE1 (NP_003381.1).
Sequence	MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTEPGPERRRSPGPAPGSPGELEEDLLLPGACP
Gene ID
Swiss Prot
Synonyms	WEE1A; WEE1hu; WEE1
Calculated MW	72kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	cytoplasm, nucleolus, nucleoplasm, nucleus.