제품 > 항체 > 단일클론항체(mAb)

XPD/ERCC2 Rabbit mAb (A19241)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using XPD/ERCC2 Rabbit mAb (A19241) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - XPD/ERCC2 Rabbit mAb (A19241)

Immunohistochemistry analysis of XPD/ERCC2 in paraffin-embedded human cervix cancer tissue using XPD/ERCC2 Rabbit mAb (A19241) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of XPD/ERCC2 in paraffin-embedded human colon tissue using XPD/ERCC2 Rabbit mAb (A19241) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of XPD/ERCC2 in paraffin-embedded mouse brain tissue using XPD/ERCC2 Rabbit mAb (A19241) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of XPD/ERCC2 in paraffin-embedded rat kidney tissue using XPD/ERCC2 Rabbit mAb (A19241) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of XPD/ERCC2 in paraffin-embedded human colon carcinoma tissue using XPD/ERCC2 Rabbit mAb (A19241) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	XPD/ERCC2 Rabbit mAb
Catalog No.	A19241
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2401

Background

The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 600-700 of human XPD/ERCC2 (P18074).
Sequence	ARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
Gene ID
Swiss Prot
Synonyms	EM9; TTD; XPD; TTD1; COFS2; TFIIH; XPD/ERCC2
Calculated MW	87kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, A-549
Cellular location	Cytoplasm, Nucleus, cytoskeleton, spindle