제품 > 항체 > 다중클론항체(pAb)

ZDHHC18 Rabbit pAb (A15199)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ZDHHC18 Rabbit pAb (A15199) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - ZDHHC18 Rabbit pAb (A15199)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using ZDHHC18 Rabbit pAb (A15199) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	ZDHHC18 Rabbit pAb
Catalog No.	A15199
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables palmitoyltransferase activity. Involved in peptidyl-L-cysteine S-palmitoylation. Located in Golgi apparatus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 301-388 of human ZDHHC18 (NP_115659.1).
Sequence	YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPACRAKPDASMVGGHP
Gene ID
Swiss Prot
Synonyms	DHHC18; DHHC-18; ZDHHC18
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Raji, HeLa, Mouse brain, Rat brain
Cellular location	Membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)