제품 > 항체 > 다중클론항체(pAb)

ZFP36 Rabbit pAb (A1878)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using ZFP36 Rabbit pAb (A1878) at 1:500 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 180 s.

Overview

Product name	ZFP36 Rabbit pAb
Catalog No.	A1878
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including 14-3-3 protein binding activity; heat shock protein binding activity; and mRNA 3'-UTR AU-rich region binding activity. Involved in several processes, including cellular response to cytokine stimulus; cellular response to growth factor stimulus; and regulation of gene expression. Acts upstream of or within mRNA catabolic process. Located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleus. Part of ribonucleoprotein complex. Colocalizes with RISC-loading complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 230-326 of human ZFP36 (NP_003398.3).
Sequence	SAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Gene ID
Swiss Prot
Synonyms	TTP; G0S24; GOS24; TIS11; NUP475; zfp-36; RNF162A; ZFP36
Calculated MW	34kDa
Observed MW	40-48kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	WiDr, HeLa, Mouse thymus
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Homo sapiens)