제품 > 항체 > 다중클론항체(pAb)

ZIP8 Rabbit pAb (A10395)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using ZIP8 antibody (A10395) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - ZIP8 Rabbit pAb (A10395)

Immunofluorescence analysis of L929 cells using ZIP8 Rabbit pAb (A10395) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	ZIP8 Rabbit pAb
Catalog No.	A10395
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import of zinc at the onset of inflammation. It is also thought to be the primary transporter of the toxic cation cadmium, which is found in cigarette smoke. Multiple transcript variants encoding different isoforms have been found for this gene. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human ZIP8 (NP_071437.3).
Sequence	QLIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
Gene ID
Swiss Prot
Synonyms	ZIP8; CDG2N; PP3105; BIGM103; LZT-Hs6
Calculated MW	50kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HL-60, NCI-H460, HeLa, Mouse liver
Cellular location	Membrane, Multi-pass membrane protein
Customer validation	WB(Bos taurus, Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus)