Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using ZP2 antibody (A10126) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of Human ovarian cancer cells using ZP2 Rabbit pAb (A10126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse ovary cells using ZP2 Rabbit pAb (A10126) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | ZP2 Rabbit pAb |
|---|---|
| Catalog No. | A10126 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 651-745 of human ZP2 (NP_003451.1). |
|---|---|
| Sequence | KMTVSLPGPILLLSDDSSFRGVGSSDLKASGSSGEKSRSETGEEVGSRGAMDTKGHKTAGDVGSKAVAAVAAFAGVVATLGFIYYLYEKRTVSNH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ZPA; Zp-2; OOMD6; OZEMA6 |
| Calculated MW | 82kDa |
| Observed MW | 68kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | SH-SY5Y, HL-60, SW620, Mouse liver, Rat ovary |
| Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein, extracellular matrix, extracellular space |
| Customer validation | WB(Mus musculus, Rattus norvegicus) IHC(Homo sapiens) IF(Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10126? Please let us know so that we can cite the reference in this datasheet.
