Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ZP3 Rabbit pAb |
---|---|
Catalog No. | A13156 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 246-345 of human ZP3 (NP_001103824.1). |
---|---|
Sequence | DASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSR |
Gene ID | |
Swiss Prot | |
Synonyms | ZPC; ZP3A; ZP3B; Zp-3; OOMD3; OZEMA3; ZP3 |
Calculated MW | 47kDa |
Observed MW | 47kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein, extracellular matrix, extracellular space |
Customer validation | IHC(Homo sapiens) WB(Rattus norvegicus, Mus musculus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13156? Please let us know so that we can cite the reference in this datasheet.