제품 > 항체 > 다중클론항체(pAb)

ZWINT Rabbit pAb (A6328)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using ZWINT antibody (A6328) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - ZWINT Rabbit pAb (A6328)

Immunofluorescence analysis of C6 cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	ZWINT Rabbit pAb
Catalog No.	A6328
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein localizes to prophase kinetochores before ZW10 does and it remains detectable on the kinetochore until late anaphase. It has a uniform distribution in the cytoplasm of interphase cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-277 of human ZWINT (NP_008988.2).
Sequence	MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
Gene ID
Swiss Prot
Synonyms	SIP30; ZWINT1; KNTC2AP; HZwint-1
Calculated MW	31kDa
Observed MW	39kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, SW620, HepG2, Jurkat, Mouse brain
Cellular location	Chromosome, Nucleus, centromere, kinetochore

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZWINT Rabbit pAb images

Western blot - ZWINT Rabbit pAb (A6328)

Immunofluorescence - ZWINT Rabbit pAb (A6328)

Immunofluorescence analysis of C6 cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - ZWINT Rabbit pAb (A6328)

Immunofluorescence analysis of HeLa cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence - ZWINT Rabbit pAb (A6328)

Immunofluorescence analysis of NIH-3T3 cells using ZWINT Polyclonal Antibody (A6328) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.