Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Zyxin Rabbit mAb |
---|---|
Catalog No. | A2298 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1906 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Zyxin (Q15942). |
---|---|
Sequence | TQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP |
Gene ID | |
Swiss Prot | |
Synonyms | ESP-2; HED-2; Zyxin |
Calculated MW | 61kDa |
Observed MW | 78kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | MCF7, Mouse lung |
Cellular location | Cell junction, Cytoplasm, Nucleus, cytoskeleton, focal adhesion. |
Customer validation | WB(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2298? Please let us know so that we can cite the reference in this datasheet.