제품 > 항체 > 단일클론항체(mAb)

alpha + beta Synuclein Rabbit mAb (A4899)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using alpha + beta Synuclein Rabbit mAb (A4899) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Western blot analysis of extracts of U-87MG cells, using alpha + beta Synuclein Rabbit mAb (A4899) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunofluorescence - alpha + beta Synuclein Rabbit mAb (A4899)

Immunofluorescence analysis of rat brain using alpha + beta Synuclein Rabbit mAb (A4899) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	alpha + beta Synuclein Rabbit mAb
Catalog No.	A4899
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1181

Background

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human alpha + beta Synuclein (P37840).
Sequence	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
Gene ID
Swiss Prot
Synonyms	NACP; PARK1; PARK4; PD1
Calculated MW	18kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-87MG, Mouse brain, Rat brain
Cellular location	actin cytoskeleton, axon, axon terminus, cell cortex, cytoplasm, cytosol, extracellular region, extracellular space, growth cone, lysosome, mitochondrion, nucleus, perinuclear region of cytoplasm, plasma membrane, postsynapse, synaptic vesicle membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

alpha + beta Synuclein Rabbit mAb images

Western blot - alpha + beta Synuclein Rabbit mAb (A4899)

Immunofluorescence - alpha + beta Synuclein Rabbit mAb (A4899)

Immunofluorescence analysis of rat brain using alpha + beta Synuclein Rabbit mAb (A4899) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.