제품 > 항체 > 다중클론항체(pAb)

cGAS Rabbit pAb (A23846)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from C2C12 cells, using cGAS Rabbit pAb (A23846) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - cGAS Rabbit pAb (A23846)

Immunofluorescence analysis of HT-29 cells using cGAS Rabbit pAb (A23846) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	cGAS Rabbit pAb
Catalog No.	A23846
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including 2', 3'-cyclic GMP-AMP synthase activity; chromatin binding activity; and phosphatidylinositol-4, 5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA; positive regulation of intracellular signal transduction; and regulation of defense response. Located in several cellular components, including cytosol; nucleus; and site of double-strand break.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 400-500 of human CGAS(NP_612450.2).
Sequence	KEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRS
Gene ID
Swiss Prot
Synonyms	MB21D1; h-cGAS; C6orf150; cGAS
Calculated MW	59kDa
Observed MW	62kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	C2C12
Cellular location
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus) IHC(Mus musculus) WB(Mus musculus) IHC(Rattus norvegicus) IF(Rattus norvegicus) IF(Mus musculus)