Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | c-Maf Rabbit pAb |
---|---|
Catalog No. | A12720 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 314-403 of human c-Maf (NP_005351.2). |
---|---|
Sequence | HVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK |
Gene ID | |
Swiss Prot | |
Synonyms | CCA4; AYGRP; c-MAF; CTRCT21; c-Maf |
Calculated MW | 38kDa |
Observed MW | 50kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse kidney, Mouse liver, Rat kidney |
Cellular location | Nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.