제품 > 항체 > 단일클론항체(mAb)

eIF4A1 Rabbit mAb (A23514)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using eIF4A1 Rabbit mAb (A23514) at 1:7000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - eIF4A1 Rabbit mAb (A23514)

Immunohistochemistry analysis of paraffin-embedded Mouse intestin using eIF4A1 Rabbit mAb (A23514) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using eIF4A1 Rabbit mAb (A23514) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - eIF4A1 Rabbit mAb (A23514)

Immunofluorescence analysis of 293T cells using eIF4A1 Rabbit mAb (A23514) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit mAb (A23514) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit mAb (A23514) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - eIF4A1 Rabbit mAb (A23514)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg eIF4A1 Rabbit mAb (A23514). Western blot was performed from the immunoprecipitate using eIF4A1 Rabbit mAb (A23514) at a dilition of 1:7000.

Overview

Product name	eIF4A1 Rabbit mAb
Catalog No.	A23514
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57329

Background

Enables double-stranded RNA binding activity. Predicted to be involved in cytoplasmic translational initiation. Located in cytoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human eIF4A1. (NP_001407.1).
Sequence	MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
Gene ID
Swiss Prot
Synonyms	DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; eIF4A1
Calculated MW	46kDa
Observed MW	48kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:7000 - 1:28000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:1800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HepG2, NIH/3T3, C2C12, C6
Cellular location