제품 > 항체 > 다중클론항체(pAb)

p53 DINP1 Rabbit pAb (A8274)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of extracts of various cell lines, using p53 DINP1 antibody (A8274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Overview

Product name	p53 DINP1 Rabbit pAb
Catalog No.	A8274
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable antioxidant activity. Involved in autophagic cell death; positive regulation of autophagy; and positive regulation of transcription, DNA-templated. Located in autophagosome; cytosol; and nucleus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p53 DINP1 (NP_001129205.1).
Sequence	MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITP
Gene ID
Swiss Prot
Synonyms	SIP; Teap; p53DINP1; TP53DINP1; TP53INP1A; TP53INP1B
Calculated MW	27kDa
Observed MW	32kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse spleen, Mouse lung
Cellular location	Cytoplasm, Cytoplasmic vesicle, Nucleus, PML body, autophagosome, cytosol