Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | p53 Rabbit mAb |
---|---|
Catalog No. | A25915 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC69779 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 281-380 of mouse p53 (NP_035770.2). |
---|---|
Sequence | TEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKT |
Gene ID | |
Swiss Prot | |
Synonyms | bbl; bfy; bhy; p44; p53; Tp53 |
Calculated MW | 43kDa |
Observed MW | 53kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | RAW 264.7 |
Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body. |
Customer validation | IP(Arabidopsis thaliana) Other(Arabidopsis thaliana) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A25915? Please let us know so that we can cite the reference in this datasheet.