제품 > 항체 > 다중클론항체(pAb)

p53 Rabbit pAb (A21630)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from 293T cells, using p53 Rabbit pAb (A21630) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - p53 Rabbit pAb (A21630)

Immunohistochemistry analysis of paraffin-embedded Human colon using p53 Rabbit pAb (A21630) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using p53 Rabbit pAb (A21630) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophageal using p53 Rabbit pAb (A21630) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using p53 Rabbit pAb (A21630) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - p53 Rabbit pAb (A21630)

Immunofluorescence analysis of HeLa cells using p53 Rabbit pAb (A21630).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

ABclonal:Immunoprecipitation - p53 Rabbit pAb (A21630)

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 3 μg p53 antibody (A21630). Western blot was performed from the immunoprecipitate using p53 antibody (A21630) at a dilution of 1:1000.

Overview

Product name	p53 Rabbit pAb
Catalog No.	A21630
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes tumor protein p53, which responds to diverse cellular stresses to regulate target genes that induce cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. p53 protein is expressed at low level in normal cells and at a high level in a variety of transformed cell lines, where it's believed to contribute to transformation and malignancy. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is postulated to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumor suppressor. Mice deficient for this gene are developmentally normal but are susceptible to spontaneous tumors. Evidence to date shows that this gene contains one promoter, in contrast to alternative promoters of the human gene, and transcribes a few of splice variants which encode different isoforms, although the biological validity or the full-length nature of some variants has not been determined.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 290-390 of mouse p53 (NP_035770.2).
Sequence	EVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
Gene ID
Swiss Prot
Synonyms	bbl; bfy; bhy; p44; p53; Tp53
Calculated MW	43kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T
Cellular location	Cytoplasm, Endoplasmic reticulum, Mitochondrion matrix, Nucleus, PML body.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

p53 Rabbit pAb images

Western blot - p53 Rabbit pAb (A21630)

Immunohistochemistry - p53 Rabbit pAb (A21630)

Immunofluorescence - p53 Rabbit pAb (A21630)

Immunofluorescence analysis of HeLa cells using p53 Rabbit pAb (A21630).Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution.

Immunoprecipitation - p53 Rabbit pAb (A21630)

* For research use only. Not for therapeutic or diagnostic purposes.