제품 > 항체 > 다중클론항체(pAb)

pan-PKC Rabbit pAb (A17922)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using pan-PKC Rabbit pAb (A17922) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - pan-PKC Rabbit pAb (A17922)

Immunofluorescence analysis of NIH-3T3 cells using pan-PKC Rabbit pAb (A17922) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	pan-PKC Rabbit pAb
Catalog No.	A17922
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 572-672 of humanPRKCA (NP_002728.2)
Sequence	MTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Gene ID
Swiss Prot
Synonyms	PRKCA/PRKCB/PRKCD/PRKCE/PRKCH/PRKCQ; pan-PKC
Calculated MW	59kDa/67kDa/74- 83kDa
Observed MW	83kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Jurkat, 293T, Mouse brain, Rat brain
Cellular location	cytoplasm, cytosol, endoplasmic reticulum, extracellular exosome, mitochondrial membrane, mitochondrion, nucleoplasm, perinuclear region of cytoplasm, plasma membrane