제품 > 항체 > 다중클론항체(pAb)

usp29 Rabbit pAb (A16564)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using usp29 Rabbit pAb (A16564) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	usp29 Rabbit pAb
Catalog No.	A16564
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable cysteine-type endopeptidase activity and thiol-dependent deubiquitinase. Predicted to be involved in G1/S transition of mitotic cell cycle and protein deubiquitination. Predicted to be active in cytosol and nucleus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of human usp29 (NP_065954.1).
Sequence	LKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVL
Gene ID
Swiss Prot
Synonyms	HOM-TES-84/86; usp29
Calculated MW	104kDa
Observed MW	100kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	U-87MG, SH-SY5Y, U-251MG
Cellular location	cytosol, nucleus, perinuclear region of cytoplasm
Customer validation	WB(Homo sapiens)