제품 > 항체 > 단일클론항체(mAb)

14-3-3 epsilon Rabbit mAb (A4933)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using 14-3-3 epsilon Rabbit mAb (A4933) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Review

Overview

Product name	14-3-3 epsilon Rabbit mAb
Catalog No.	A4933
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1222

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 14-3-3 epsilon (P62258).
Sequence	MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI
Gene ID
Swiss Prot
Synonyms	MDS; HEL2; MDCR; KCIP-1; 14-3-3E
Calculated MW	29kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Mouse brain, Mouse kidney, Rat lung, Rat brain
Cellular location	Cytoplasm, Melanosome
Customer validation	(293T、 hela 、A549、HEPG2 、 PC-3、HL-60、RPMI-8226、MLOT-4 、MCF-7, 293T, Hela, A549, HepG2, PC-3, HL-60, RPMI-8226, MOLT-4, MCF-7) WB(Mus musculus)