제품 > 항체 > 다중클론항체(pAb)

14-3-3 epsilon Rabbit pAb (A1058)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using 14-3-3 epsilon Rabbit pAb (A1058) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - 14-3-3 epsilon Rabbit pAb (A1058)

Immunofluorescence analysis of H9C2 cells using 14-3-3 epsilon Rabbit pAb (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using 14-3-3 epsilon Rabbit pAb (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using 14-3-3 epsilon Rabbit pAb (A1058) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	14-3-3 epsilon Rabbit pAb
Catalog No.	A1058
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 73-163 of human 14-3-3 epsilon (NP_006752.1).
Sequence	KGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTEL
Gene ID
Swiss Prot
Synonyms	MDS; HEL2; MDCR; KCIP-1; 14-3-3E; 14-3-3 epsilon
Calculated MW	29kDa
Observed MW	29-32Kda

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, U-251MG, Mouse brain, Mouse kidney, Mouse lung, Rat brain, Rat kidney, Rat lung
Cellular location	Cytoplasm, Melanosome.
Customer validation	WB(Homo sapiens)