제품 > 항체 > 다중클론항체(pAb)

β1-Adrenergic Receptor Rabbit pAb (A20818)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using β1-Adrenergic Receptor Rabbit pAb (A20818) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	β1-Adrenergic Receptor Rabbit pAb
Catalog No.	A20818
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human β1-Adrenergic Receptor (NP_000675.1).
Sequence	HRELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAG
Gene ID
Swiss Prot
Synonyms	RHR; B1AR; FNSS2; ADRB1R; BETA1AR; β1-Adrenergic Receptor
Calculated MW	51kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, Mouse heart, Rat heart
Cellular location	early endosome, neuronal dense core vesicle, plasma membrane, Schaffer collateral - CA1 synapse.
Customer validation	WB(Homo sapiens, Mus musculus)