제품 > 항체 > 다중클론항체(pAb)

ADRB1 Rabbit pAb (A16334)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using ADRB1 Rabbit pAb (A16334) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - ADRB1 Rabbit pAb (A16334)

Immunofluorescence analysis of paraffin-embedded Rat spleen using ADRB1 Rabbit pAb ( A16334) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	ADRB1 Rabbit pAb
Catalog No.	A16334
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Beta-1 adrenoceptors are predominately located in the heart. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADRB1 (NP_000675.1).
Sequence	CVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFRE
Gene ID
Swiss Prot
Synonyms	RHR; B1AR; FNSS2; ADRB1R; BETA1AR; ADRB1
Calculated MW	51kDa
Observed MW	51kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	mouse brain, rat spinal cord
Cellular location	early endosome, neuronal dense core vesicle, plasma membrane, Schaffer collateral - CA1 synapse
Customer validation	(spleen)