Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | 4-1BBL/CD137L Rabbit mAb |
---|---|
Catalog No. | A3386 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1963 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 155-254 of human 4-1BBL/CD137L (P41273). |
---|---|
Sequence | GEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Gene ID | |
Swiss Prot | |
Synonyms | CD137L; TNLG5A; 4-1BB-L; 4-1BBL/CD137L |
Calculated MW | 27kDa |
Observed MW | 27kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, Raji, SH-SY5Y, Mouse lung, Mouse brain, Rat lung |
Cellular location | Membrane, Single-pass type II membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.