제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human C5AR1/CD88 mAb (A26403)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human C5AR1/CD88 mAb (A26403, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human C5AR1/CD88 mAb (A26403, 5 μl/Test, right).

Flow cytometry: 1X10^6 Human peripheral blood cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human C5AR1/CD88 mAb (A26403, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human C5AR1/CD88 mAb
Catalog No.	A26403
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68667-ABflo488

Background

Enables G protein-coupled receptor activity and complement component C5a receptor activity. Involved in several processes, including complement component C5a signaling pathway; mRNA transcription by RNA polymerase II; and positive regulation of ERK1 and ERK2 cascade. Located in apical part of cell and basolateral plasma membrane. Biomarker of Alzheimer's disease; asthma; chronic obstructive pulmonary disease; rhinitis; and severe acute respiratory syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human C5AR1/CD88 (NP_001727.2).
Sequence	MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHH
Gene ID
Swiss Prot
Synonyms	C5A; C5AR; C5R1; CD88
Calculated MW	39kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Cytoplasmic vesicle, Multi-pass membrane protein.