제품 > 항체 > 단일클론항체(mAb)

C5AR1 Rabbit PolymAb® (A26421PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using C5AR1 Rabbit PolymAb® (A26421PM) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - C5AR1 Rabbit PolymAb® (A26421PM)

Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using C5AR1 Rabbit PolymAb® (A26421PM) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using C5AR1 Rabbit PolymAb® (A26421PM) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using C5AR1 Rabbit PolymAb® (A26421PM) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.

Overview

Product name	C5AR1 Rabbit PolymAb®
Catalog No.	A26421PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables G protein-coupled receptor activity and complement component C5a receptor activity. Involved in several processes, including complement component C5a signaling pathway; mRNA transcription by RNA polymerase II; and positive regulation of ERK1 and ERK2 cascade. Located in apical part of cell and basolateral plasma membrane. Biomarker of Alzheimer's disease; asthma; chronic obstructive pulmonary disease; rhinitis; and severe acute respiratory syndrome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human C5AR1 (NP_001727.2).
Sequence	MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHH
Gene ID
Swiss Prot
Synonyms	C5A; C5AR; C5R1; CD88
Calculated MW	39kDa
Observed MW	39-45kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:2000 - 1:8000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Rat liver
Cellular location	Cell membrane, Cytoplasmic vesicle, Multi-pass membrane protein.