Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 488 Rabbit anti-Human CD200/OX2 mAb |
---|---|
Catalog No. | A23741 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC60912-ABf488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 31-232 of human CD200/OX2 (NP_001352780.1). |
---|---|
Sequence | QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG |
Gene ID | |
Swiss Prot | |
Synonyms | CD200; MOX1; MOX2; MRC; OX-2; CD200 molecule |
Calculated MW | 30kDa/31kDa/32kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Axon, neuron projection, plasma membran |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.