제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD200/OX2 mAb (A23743)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells(negative control, left) and SK-MEL-28 cells (right) were surface-stained with ABflo® 594 Rabbit anti-Human CD200/OX2 mAb(A23743, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 SK-MEL-28 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD200/OX2 mAb(A23743, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD200/OX2 mAb
Catalog No.	A23743
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60912-ABf594

Background

This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-232 of human CD200/OX2 (NP_001352780.1).
Sequence	QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
Gene ID
Swiss Prot
Synonyms	CD200; MOX1; MOX2; MRC; OX-2; CD200 molecule
Calculated MW	30kDa/31kDa/32kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Axon, neuron projection, plasma membran

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Human CD200/OX2 mAb images

Flow CytoMetry - ABflo® 594 Rabbit anti-Human CD200/OX2 mAb (A23743)

Flow cytometry:1X10^6 SK-MEL-28 cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD200/OX2 mAb(A23743, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.