Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 488 Rabbit anti-Human CD300c mAb |
---|---|
Catalog No. | A24097 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC64148-ABflo488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1). |
---|---|
Sequence | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR |
Gene ID | |
Swiss Prot | |
Synonyms | LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1 |
Calculated MW | 25kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Immunofluorescence Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.