제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 A549 cells (negative control, left) and HeLa cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD317/BST2 mAb(A22517, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human BST2 mAb(A22517, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD317/BST2 mAb
Catalog No.	A22517
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56691-ABf488

Background

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human CD317/BST2 (NP_004326.1).
Sequence	NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Gene ID
Swiss Prot
Synonyms	CD317; HM1.24; TETHERIN
Calculated MW	18kDa/19kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	apical plasma membrane, cell surface, extracellular exosome, Golgi apparatus, multivesicular body, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD317/BST2 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD317/BST2 mAb (A22517)

Flow cytometry:1X10^6 Hela cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human BST2 mAb(A22517, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.