제품 > 항체 > 단일클론항체(mAb)

BST2 Rabbit mAb (A23445)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse liver, using BST2 Rabbit mAb (A23445) at 1:30000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - BST2 Rabbit mAb (A23445)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using BST2 Rabbit mAb (A23445) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen using BST2 Rabbit mAb (A23445) at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - BST2 Rabbit mAb (A23445)

Confocal imaging of HeLa cells using BST2 Rabbit mAb (A23445, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	BST2 Rabbit mAb
Catalog No.	A23445
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC56688

Background

Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 49-160 of human BST2. (NP_004326.1).
Sequence	NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDS
Gene ID
Swiss Prot
Synonyms	CD317; HM1.24; TETHERIN; BST2
Calculated MW	20kDa
Observed MW	28-40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:30000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Mouse liver
Cellular location	Apical cell membrane, Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Late endosome, Lipid-anchor, Membrane raft, Single-pass type II membrane protein, trans-Golgi network
Customer validation	IF(Mus musculus)