제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb (A22485)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and HT-29 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb (A22485, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells (Low Expression) were surface-stained with ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb (A22485, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained HeLa cells was used as blank control (red line).

Flow cytometry: 1X10^6 HT-29 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb (A22485, 5 μl/Test, right).

Flow cytometry: 1X10^6 HeLa cells (Low Expression) were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb (A22485, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD326/EPCAM mAb
Catalog No.	A22485
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57676-ABf488

Background

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of human CD326/EPCAM (NP_002345.2).
Sequence	QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Gene ID
Swiss Prot
Synonyms	ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1
Calculated MW	35kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Apical plasma membrane, Basolateral plasma membrane, Bicellular tight junction, Extracellular exosome, Lateral plasma membrane, Plasma membrane