제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 A204 cells (Low Expression, left) and MCF7 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, right).

Flow cytometry:1X10^6 A204 cells(Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, right).

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained Human PBMC was used as blank control (red line).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD58 mAb
Catalog No.	A22512
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54829-ABf488

Background

This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-215 of human CD58 (NP_001770.1).
Sequence	FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
Gene ID
Swiss Prot
Synonyms	ag3; LFA3; LFA-3
Calculated MW	28kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

ABflo® 488 Rabbit anti-Human CD58 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)

Flow cytometry:1X10^6 MCF7 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD58 mAb(A22512, 5 μl/Test, right).

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD58 mAb (A22512)

* For research use only. Not for therapeutic or diagnostic purposes.