제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human Podoplanin mAb (A24408)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 knockout (KO) 293T cells (negative control, Left) and 293T (right) cells were surface-stained with ABflo® 488 Rabbit anti-Human Podoplanin mAb(A24408, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293T cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human Podoplanin mAb(A24408, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human Podoplanin mAb
Catalog No.	A24408
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63004-ABflo488

Background

This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin(NM_006474.5).
Sequence	EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
Gene ID
Swiss Prot
Synonyms	PDPN; AGGRUS; GP36; GP40; Gp38; HT1A-1; OTS8; PA2.26; T1A; T1A-2; T1A2; TI1A; podoplanin
Calculated MW	12kDa/16kDa/18kDa/24kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell projection, Membrane, Single-pass type I membrane protein, filopodium membrane, lamellipodium membrane, microvillus membrane, ruffle membrane