제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human Podoplanin mAb (A26770)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 knockout (KO) 293T cells (negative control, left) and 293T (right) cells were surface-stained with PE Rabbit anti-Human Podoplanin mAb (A26770, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human Podoplanin mAb (A26770, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human Podoplanin mAb
Catalog No.	A26770
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63004-PE

Background

This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-123 of Human Podoplanin (NP_006465.4).
Sequence	EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEK
Gene ID
Swiss Prot
Synonyms	T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; D2-40; T1A-2; AGGRUS; HT1A-1; PA2.26
Calculated MW	17kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	anchoring junction, apical plasma membrane, basolateral plasma membrane, cell junction, cytoplasmic vesicle, cytosol, filopodium membrane, lamellipodium membrane, microvillus membrane, mitochondrion, plasma membrane, ruffle membrane, tetraspanin-enriched microdomain, Cell projection, Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구세포 생물학 & 발달 생물학세포주기중심체

PE Rabbit anti-Human Podoplanin mAb images

Flow CytoMetry - PE Rabbit anti-Human Podoplanin mAb (A26770)

Flow cytometry: 1X10^6 293T cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human Podoplanin mAb (A26770, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.