제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD215/IL-15Rα mAb (A25573)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of 293F cells transfected with CD215/IL-15Rα using ABflo® 488 Rabbit anti-Mouse CD215/IL-15Rα mAb (A25573, dilution 1:50). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 488 Rabbit anti-Mouse CD215/IL-15Rα mAb (A25573)

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Mouse CD215/IL-15Rα mAb (A25573, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD215/IL-15Rα mAb
Catalog No.	A25573
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66399-ABflo488

Background

Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 33-205 of mouse CD215/IL-15Rα ( NP_032384.1).
Sequence	GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Gene ID
Swiss Prot
Synonyms	Il15ra
Calculated MW	28kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane By Similarity, Single-pass type I membrane protein, Nucleus membrane, Cell surface