제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Mouse CD226/DNAM-1 mAb (A25862)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Mouse CD226/DNAM-1 mAb (A25862, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Mouse CD226/DNAM-1 mAb (A25862, 5 μl/Test, right).

Flow cytometry:1X10^6 C57BL/6 Splenocytes cells were surface-stained with ABflo® 647 Rabbit anti-Mouse CD8a mAb (A23904, 5 μl/Test) and ABflo® 488 Rabbit anti-Mouse CD226/DNAM-1 mAb (A25862, 5 μl/Test, left) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Mouse CD226/DNAM-1 mAb
Catalog No.	A25862
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67159-ABflo488

Background

Predicted to enable integrin binding activity and protein kinase binding activity. Acts upstream of or within positive regulation of interferon-gamma production and positive regulation of natural killer cell cytokine production. Located in external side of plasma membrane. Is expressed in embryo. Orthologous to human CD226 (CD226 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-254 of mouse CD226/DNAM-1 (NP_848802.2).
Sequence	EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Gene ID
Swiss Prot
Synonyms	Pta1; DNAM1; DNAM-1; TLiSA1
Calculated MW	38kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, single-pass type I membrane protein