제품 > 항체 > 단일클론항체(mAb)

CD226 Rabbit mAb (A25908)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with CD226 Rabbit mAb (A25908, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD226 Rabbit mAb (A25908, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Flow cytometry: 1X10^6 C57BL/6 Splenocytes cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD226 Rabbit mAb (A25908, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD226 Rabbit mAb
Catalog No.	A25908
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC67159

Background

Predicted to enable integrin binding activity and protein kinase binding activity. Acts upstream of or within positive regulation of interferon-gamma production and positive regulation of natural killer cell cytokine production. Located in external side of plasma membrane. Is expressed in embryo. Orthologous to human CD226 (CD226 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-254 of mouse CD226 (NP_848802.2).
Sequence	EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Gene ID
Swiss Prot
Synonyms	Pta1; DNAM1; DNAM-1; TLiSA1
Calculated MW	38kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, single-pass type I membrane protein