제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A23854)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HEL cells(negative control, left) and HeLa cells(right) were surface-stained with ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb(A23854, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HeLa cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb(A23854, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb
Catalog No.	A23854
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61149-ABf594

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262/DR5/TRAILR2（NP_003833.4）
Sequence	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Gene ID
Swiss Prot
Synonyms	TNFRSF10B; CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9; TNF receptor superfamily member 10b
Calculated MW	12kDa/45kDa/47kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb images

Flow CytoMetry - ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A23854)

Flow cytometry:1X10^6 HeLa cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD262/DR5/TRAILR2 mAb(A23854, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.