제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A26741)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HEL cells (negative control, left) and HeLa cells (right) were surface-stained with PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A26741, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A26741, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb
Catalog No.	A26741
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61149-PE

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262/DR5/TRAILR2 (NP_003833.4).
Sequence	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Gene ID
Swiss Prot
Synonyms	DR5; CD262; KILLER; TRICK2; TRICKB; ZTNFR9; TRAILR2; TRICK2A; TRICK2B; TRAIL-R2; KILLER/DR5
Calculated MW	48kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb images

Flow CytoMetry - PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A26741)

Flow cytometry: 1X10^6 HeLa cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD262/DR5/TRAILR2 mAb (A26741, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.