제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human CD62E/E-Selectin mAb (A24310)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 HUVEC cells (negative control, Left) and HUVEC cells(treated with TNF-α, Right) were surface-stained with ABflo® 594 Rabbit anti-Human CD62E/E-Selectin mAb(A24310, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HUVEC cells(treated with TNF-α, Right) were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human CD62E/E-Selectin mAb(A24310, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human CD62E/E-Selectin mAb
Catalog No.	A24310
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61987-ABflo594

Background

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-230 of human CD62E/E-Selectin (NP_000441.2).
Sequence	WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEW
Gene ID
Swiss Prot
Synonyms	SELE; CD62E; ELAM; ELAM1; ESEL; LECAM2; E-selectin
Calculated MW	66kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein