제품 > 항체 > 단일클론항체(mAb)

CD62E/E-Selectin Rabbit mAb (A23836)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of Recombinant Human SELE/E-selectin/CD62E Protein (RP00293), using CD62E/E-Selectin Rabbit mAb (A23836) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Flow CytoMetry - CD62E/E-Selectin Rabbit mAb (A23836)

Flow cytometry: 1X10^6 HUVEC cells (negative control, Left) and HUVEC cells(treated with TNF-α, Right) were surface-stained with CD62E/E-Selectin Rabbit mAb(A23836, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line), followed by Alexa Fluor®647 conjugated goat anti-rabbit pAb (1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 HUVEC cells(treated with TNF-α, Right) were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or CD62E/E-Selectin Rabbit mAb(A23836, 2 μg/mL, right).

Overview

Product name	CD62E/E-Selectin Rabbit mAb
Catalog No.	A23836
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61987

Background

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-230 of human CD62E/E-Selectin (NP_000441.2).
Sequence	WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEW
Gene ID
Swiss Prot
Synonyms	SELE; CD62E; ELAM; ELAM1; ESEL; LECAM2; E-selectin; CD62E/E-Selectin
Calculated MW	66kDa
Observed MW	110-120kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Recombinant Human E-Selectin/CD62E Protein
Cellular location	Cell membrane, Single-pass type I membrane protein.