제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human IL-17RB mAb (A24317)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry:1X10^6 MOLT-4 cells (negative control, Left) and HepG2 cells (Right) were surface-stained with ABflo® 594 Rabbit anti-Human IL-17RB mAb(A24317, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	ABflo® 594 Rabbit anti-Human IL-17RB mAb
Catalog No.	A24317
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62205-ABflo594

Background

The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-289 of human IL-17RB (NP_061195.2).
Sequence	REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPLDNNKSKPGG
Gene ID
Swiss Prot
Synonyms	IL17RB; CRL4; EVI27; IL17BR; IL17RH1; interleukin-17 receptor B
Calculated MW	31kDa/55kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Secreted, Single-pass type I membrane protein