Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | ABflo® 594 Rabbit anti-Mouse CD161c/NK1.1 mAb |
---|---|
Catalog No. | A24923 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57666-ABf594 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 67-223 of mouse CD161c/NK1.1 (NP_001153376.2). |
---|---|
Sequence | QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS |
Gene ID | |
Swiss Prot | |
Synonyms | Nk1; Ly59; Nk-1; CD161; Ly-59; Ly55c; NK1.1; NKRP1; Nk1.2; Klrb1b; NK-RP1; Nk-1.2; Nkrp1b; Nkrp1c; ly-55c; NKRP140; NKR-P1.9 |
Calculated MW | 25kDa |
Observed MW | Refer to figures |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Membrane, Single-pass type II membrane protein. |
Customer validation | (mouse spleen) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr