제품 > 항체 > 단일클론항체(mAb)

ABflo® 700 Rabbit anti-Mouse CD161c/NK1.1 mAb (A27430)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with FITC Anti-Mouse CD3e mAb, (A23322, 2 μg/mL) and ABflo® 700 Rabbit IgG isotype control (A25976, 5 μl/Test, left) or ABflo® 700 Rabbit anti-Mouse CD161c/NK1.1 mAb (A27430, 5 μl/Test, right).

Overview

Product name	ABflo® 700 Rabbit anti-Mouse CD161c/NK1.1 mAb
Catalog No.	A27430
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57666-ABflo700

Background

Enables identical protein binding activity and signaling receptor activity. Acts upstream of or within natural killer cell activation and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in thymus primordium. Orthologous to human KLRB1 (killer cell lectin like receptor B1).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 67-223 of mouse CD161c/NK1.1 (NP_001153376.2).
Sequence	QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKG ATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTEN GSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
Gene ID
Swiss Prot
Synonyms	Nk1; Ly59; Nk-1; CD161; Ly-59; Ly55c; NK1.1; NKRP1; Nk1.2; Klrb1b; NK-RP1; Nk-1.2; Nkrp1b; Nkrp1c; ly-55c; NKRP140; NKR-P1.9
Calculated MW	25kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type II membrane protein.