Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
| Product name | PE Rabbit anti-Mouse CD161c/NK1.1 mAb |
|---|---|
| Catalog No. | A24107 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC57668-PE |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 67-223 of mouse CD161/NK1.1 (NP_001153376.2). |
|---|---|
| Sequence | QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKG ATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTEN GSCASILGDKVTPESCASDNRWICQKELNHETPSNDS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | Nk1; Ly59; Nk-1; CD161; Ly-59; Ly55c; NK1.1; NKRP1; Nk1.2; Klrb1b; NK-RP1; Nk-1.2; Nkrp1b; Nkrp1c; ly-55c; NKRP140; NKR-P1.9 |
| Calculated MW | 25kDa |
| Observed MW |
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | Membrane, Single-pass type II membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
